DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG17189

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001356927.1 Gene:CG17189 FlyBaseID:FBgn0039485 Length:271 Species:Drosophila melanogaster

Alignment Length:246 Identity:43/247 (17%)
Similarity:92/247 (37%) Gaps:50/247 (20%)


  Fly    16 ILYACLSPAACV---------------YEAKI----LAFLQEFRMRMCHPIPNL--GLPALDPLQ 59
            :|:|.|..|.||               ||.:.    ...:|.|..::...:|.:  ....:||::
  Fly     9 LLHAGLQGAQCVAFYTEKPSYIESCKIYEPEFTKCSTRSIQAFMNQLVKGVPEIEESFGPIDPMR 73

  Fly    60 LGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTIN----VTLPLTYFKSLY 120
            ......:.:|..:...:.::.:..:.|.....:....:|     |...:    :.||.......|
  Fly    74 QEQLVFKQDNSDVATLSANLTDMLIRGFGKMLIKESKVS-----KKDFSWLTKIYLPQMRIDGHY 133

  Fly   121 TAKGSLAYILNLAGDGNAETSITNFSILISFRLR-----SVSPLAISSLQIELRLGGLWINFDNL 180
            ...|.: .::.|.|:|.....|.:..||::.:.|     ..:...::|:::::.:|.:....|||
  Fly   134 KMVGRI-LLVPLQGNGKIVMEIDDLDILMTTKTRLYEKGGYTFYNVTSVKVKVDVGKVRTRLDNL 197

  Fly   181 ME------EDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFL 225
            ..      ||..|.|.:        :...||::..:..||..|:..:.:.|
  Fly   198 FNGHSKEVEDSTNQFFN--------DNWKDVFEALRPLVVETVERTLLDLL 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 35/216 (16%)
CG17189NP_001356927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406925
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.