DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG14259

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster

Alignment Length:254 Identity:50/255 (20%)
Similarity:92/255 (36%) Gaps:59/255 (23%)


  Fly    12 LATAILYACLSPA---AC-VYEA--------KILAFLQEFRMRMCHPIPNLGLPAL-------DP 57
            |.:|:.|....||   :| :||.        .|...|.:.         |:|:|.:       ||
  Fly    32 LVSAVAYYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQL---------NIGIPEVLERFGPFDP 87

  Fly    58 LQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTA 122
            :::.....:.:|..:.....::.:..:.|.::..|....:|.......| .:.||.......|..
  Fly    88 MRVRDIVFKQDNNEVATIRANLTDLVVKGFANTKVKESRVSKKDFSWQT-KIYLPKMRLDGRYEM 151

  Fly   123 KGSLAYILNLAGDGNAETSITNFSILISFRLRSVSPLA-----ISSLQIELRLGGLWINFDNLME 182
            .|.: .::.|:|.|.....|.:..||:..::|......     ::::|::|.|..:....|||..
  Fly   152 AGRI-LLIPLSGSGKIFIEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFN 215

  Fly   183 ------EDRINDF-----------IHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNF 224
                  |...|:|           :..|:.|....:|.||    ..||...:.|   ||
  Fly   216 GRSKEVERSTNEFFNENWRDFYEALKPLIVETVENILYDV----MSTVFHLIPA---NF 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 42/223 (19%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 50/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406960
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.