DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG11854

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster

Alignment Length:258 Identity:52/259 (20%)
Similarity:102/259 (39%) Gaps:39/259 (15%)


  Fly     9 QVLLATAILYACLS--------PA----ACVYEAKILAFLQEFRMR--MCHPIPNLGLPALDPLQ 59
            ::.||..:|:.|.|        |:    ..:.:.:.|.....|.:|  ....|..|||..||||.
  Fly     2 ELTLALVLLFGCASTYGHASDFPSGIERCAIMDEQCLEDRVNFVLRNYAKSGIKELGLIPLDPLH 66

  Fly    60 LGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTINVTL--PLTYFKSLYTA 122
            :...:...|....|:...|.....:.||.......:| .....|..:|.:.:  |....:..|:.
  Fly    67 VKKFKIGRNPHSPVNIDLSFHEMDILGLHQGVAKRVS-GFTRDLSRSIELVMEVPEIGVRGPYSV 130

  Fly   123 KGSLAYILNLAGDGNAETSITNFSILISFRLRSVSP------LAISSLQIELRLGGLWINFDNLM 181
            .|.: .||.:.|:|.|:..:|...:....:|:.||.      ..:.::::||....:....:||.
  Fly   131 DGRI-LILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVELDPSHVTYQLENLF 194

  Fly   182 EEDR-INDFIHALVNEMGVEL-------LGDVWDYEQGTVVSKVQAAVNNFLGQYSLSDIIQI 236
            ...: :::.:|||:||...::       :|:.:    |.:...|   |:...|:..|..:..:
  Fly   195 NGQKDLSENMHALINENWKDIFNELKPGIGEAF----GLIAKSV---VDRIFGKLPLEQLFVV 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 46/217 (21%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 47/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406678
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.