DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG13618

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster

Alignment Length:189 Identity:37/190 (19%)
Similarity:78/190 (41%) Gaps:32/190 (17%)


  Fly    20 CLSPAACVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQL 84
            ||..|..|...::.|..:||           |:|.|:||.:.....:..|. .::...::.|.::
  Fly    44 CLVDAVNVAIQQLKAGNREF-----------GIPPLEPLTVKKLVIDAGNA-PINLRQALKNVKV 96

  Fly    85 HGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKS-------LYTAKGSLAYILNLAGDGNAETSI 142
            |.:       :|.|.:...:..::..|.:...::       .|...|.: .:|.:.|.|.|..::
  Fly    97 HDM-------ISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRI-LLLPITGHGKANVTL 153

  Fly   143 TNFSI---LIS--FRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNE 196
            .|..|   ||.  |....|..:.:...::......:::||:||..:..::|.::..:||
  Fly   154 INTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFNDKTLSDGMNRFLNE 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 33/178 (19%)
CG13618NP_651265.1 JHBP 13..251 CDD:284096 37/190 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407028
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.