DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG17279

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster

Alignment Length:206 Identity:46/207 (22%)
Similarity:83/207 (40%) Gaps:35/207 (17%)


  Fly    40 RMRMCHP--IPNLGLPALDPLQLGPAETELNNKYLVDFTGSID----NFQLHGLSD--------F 90
            |:...:|  :|::||.|||.:..   |..:.::...|.:.:.|    |..:.|.:|        |
  Fly    40 RILRLYPKGLPSIGLVALDSIGF---EDVVVSRLEPDGSSTFDLKFPNLTVIGFADSTVTEAKGF 101

  Fly    91 DVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR--- 152
            |.....:..:.|       .:||......|..:||| ..:.:.|.|.|:..|....:....|   
  Fly   102 DADLPRVLELSG-------WIPLLKLNGTYEMRGSL-LTMPIHGKGQAKVEIRECRVRCKVRVLE 158

  Fly   153 -LRSVSPL--AISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLGDVWDYEQGTVV 214
             ||....|  .||.::..|.:.|:.:|.:||.....::|.::.:.|...:|    :|...:..:.
  Fly   159 DLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVVANTKWLE----IWHNLRRGIT 219

  Fly   215 SKVQAAVNNFL 225
            |.|...|.:.|
  Fly   220 SAVDQLVESIL 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 46/207 (22%)
CG17279NP_650937.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407508
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.