DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG31189

DIOPT Version :10

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:197 Identity:50/197 - (25%)
Similarity:75/197 - (38%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IPNLGLPALDPLQLGPA---ETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGL----- 103
            ||.:|||.||......:   |:.......:||. ..||.. .|.::     .:::.|.|.     
  Fly    53 IPEIGLPPLDAYNFPDSVIMESPSRGPIWMDFR-MRDNVN-KGFNN-----ATITHVEGFLYEPN 110

  Fly   104 --KNTINVTLPLTYFKSLYTAKGS-LAYILNLAGDGNAETSITNFSI------LISFRLRSVSPL 159
              :..:.|.||....::.|...|. |.:..|..  |...:...||.|      |:.:| .....|
  Fly   111 QKQIVLKVRLPRLVHEATYDMSGRVLLFFFNTT--GRLISDFQNFRITLTIKALVEYR-NDKRYL 172

  Fly   160 AISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNEMGVELLGDVW-DYEQGTVVSKVQAAVN 222
            .|.:|...|.|....|..|.|.:|:. :..|::.|.||..||.    | |.:.|.    |:|..|
  Fly   173 KIYNLVPSLDLDRWIIWLDGLYKENTDVTIFMNKLFNENWVEF----WNDLQPGL----VKAFTN 229

  Fly   223 NF 224
            .|
  Fly   230 AF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:472279 50/197 (25%)
CG31189NP_732580.3 JHBP 9..249 CDD:461956 50/197 (25%)

Return to query results.
Submit another query.