DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG10407

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:108/224 - (48%) Gaps:28/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSI------DNFQL 84
            ||.|:     .:|.|.|:...||.|.:||::||.:...:.:.:       :|:|      .|.::
  Fly    51 CVRES-----YEELRPRLMEGIPELYIPAMEPLVVPQVKMDQD-------SGAIYLHSVYRNVKV 103

  Fly    85 HGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKGS---LAYILNLAGDGNAETSITNFS 146
            .|:|...|..|.|.| ..||..:::|.|..:.:|.|:.|.|   ...::.|.|||:.:..:.|.:
  Fly   104 TGISKHTVNELRLEP-SKLKFILSLTFPKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNIT 167

  Fly   147 I---LI--SFRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNEMGVELLGDV 205
            :   ||  .::....:.|.|::::::..|..:.|:.|||...|: :.|.::..:||....|..:|
  Fly   168 MRTELIGQEYKKNGANFLKINTVKVKYELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEV 232

  Fly   206 WDYEQGTVVSKVQAAVNNFLGQYSLSDII 234
            .......:|..::|:|:.....:|..|::
  Fly   233 RPLMTKALVDILRASVDKLFASFSYDDLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 51/213 (24%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 55/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.