DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG10264

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster

Alignment Length:182 Identity:43/183 (23%)
Similarity:81/183 (44%) Gaps:17/183 (9%)


  Fly    44 CHP-----IPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGL 103
            |.|     ||.:|:.:.:||.:........:..|| .:|...:..:.|.|:..|...||.....|
  Fly    69 CFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLV-LSGGFQDLVIRGPSNATVRRASLDLERRL 132

  Fly   104 KNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR--LRSVSP-----LAI 161
            .| ..:.||....::.|..||:: .:|.|.|.|:...::.|....:..|  ||:.:.     :.|
  Fly   133 LN-FELELPRLRIRAKYNLKGNI-LLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHI 195

  Fly   162 SSLQIELRLGGLWINFDNLMEEDRI-NDFIHALVNEMGVELLGDVW-DYEQG 211
            ..:::...:|.:.|:..||...:.| ...|::.:|:.|.|::.::. |.|.|
  Fly   196 DEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELG 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 43/183 (23%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 43/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407565
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.