DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG1124

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster

Alignment Length:167 Identity:35/168 (21%)
Similarity:72/168 (43%) Gaps:31/168 (18%)


  Fly    36 LQEFRMRMCHPIPNLGLPALDPLQLGPAETELN---NKYLVDFTGSIDNFQLHGLSDFDVPALSL 97
            ::..:..:.:.||::.||:::|.::.....:|.   ..|.:    ::.|.:..|.|:|.|.:|.|
  Fly    43 IEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKI----TLKNMEAFGASNFKVTSLKL 103

  Fly    98 S----PVPGLKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGN-------------AETSITNF 145
            |    |...     .:.:|....::.||:.|.| .||..:|.|:             .:|||..|
  Fly   104 SEGSEPFKA-----KIVMPKLKIEAKYTSSGVL-LILPASGGGDFHANFEGVSADLTGKTSIHAF 162

  Fly   146 SILISFRLRSVSPLAISSLQIELRLGGLWINFDNLME 182
            .......:.::| |.:....:::.:.|.:.|...|:|
  Fly   163 KGANYLHIDALS-LVLDVKDVKMSISGAFNNNRILLE 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 35/168 (21%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 35/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406580
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.