DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG14661

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001246918.1 Gene:CG14661 FlyBaseID:FBgn0037288 Length:246 Species:Drosophila melanogaster

Alignment Length:221 Identity:46/222 (21%)
Similarity:85/222 (38%) Gaps:49/222 (22%)


  Fly     9 QVLLATAILYACLSPAACVYEAKILAFLQEFRMRMCH-----------------------PIPNL 50
            |..|..|.|..|.  .||:....:..::|     :||                       .|..|
  Fly     2 QFQLIVASLLICF--VACISAGNMPDYIQ-----VCHRNDPELSKCLKSSVHNLRPYLAKGIKEL 59

  Fly    51 GLPALDPLQLGPAETELNNKYLVD----FTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTINVTL 111
            .:|.|:||.:|...       ::|    .|.......:.|.|:|::..|..| ....:....:.|
  Fly    60 NVPPLEPLYIGDLS-------ILDGSAGLTVKAKKLNILGASNFEITKLRAS-TQNRRFDFELIL 116

  Fly   112 PLTYFKSLYTAKGSLAYILNLAGDGNAETSITNF--SILISFRLRSVSPLA---ISSLQIELRLG 171
            |..:...||...|:: ..|.:.|:|....:.|||  .:.:.:.::||:.|.   :....:::|.|
  Fly   117 PHLHGDGLYEINGNI-LALPIKGNGPFTGNFTNFVAYVRVQYDIKSVNDLEYLHVKEFVLKIRTG 180

  Fly   172 GLWINFDNLMEEDRI-NDFIHALVNE 196
            ...:..:||...|:: .|.|:..:|:
  Fly   181 KGNLKLENLFNGDKVLGDVINDTINQ 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 39/199 (20%)
CG14661NP_001246918.1 JHBP 10..245 CDD:284096 43/214 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406800
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.