DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG14457

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:253 Identity:50/254 (20%)
Similarity:88/254 (35%) Gaps:66/254 (26%)


  Fly     4 AKLTSQVLLATAILYACL---------SPAACVYEAKILAFLQEFRMRMCHPIPNL------GLP 53
            |:|...|||.|  ...||         .|...:.|.:|..  ::|.....|.|..|      |:|
  Fly     2 ARLELIVLLVT--FTTCLVRAEDGFLKEPPDYIKECRIAD--KDFVNCSTHSIQQLFDKLNDGIP 62

  Fly    54 AL------DPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTI----- 107
            .|      ||..|........|...::....:.|.::.|....:|          |.:.:     
  Fly    63 GLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNV----------LDSQVFKKDY 117

  Fly   108 ----NVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFRLRSVSP-----LAISS 163
                ..|||....::.|:..|.: .::.|.|.|.......|.::.:..:.|..|.     ..:::
  Fly   118 SWKTTFTLPEMKLQADYSLFGRI-LLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTN 181

  Fly   164 LQIELRLGGLWINFDNLME-----EDRINDF-----------IHALVNEMGVELLGDV 205
            |.::.::.||...|.||..     ||..|.|           ::.::.:...::|.||
  Fly   182 LHVDFKMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDV 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 40/217 (18%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 48/250 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406830
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.