DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG33680

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:211 Identity:44/212 (21%)
Similarity:76/212 (36%) Gaps:63/212 (30%)


  Fly    16 ILYACLSPAA--------CVYEAKILAFLQEFRMRMCHPIPNLGLPA--LDPLQLGPAETELNNK 70
            :|...::|.|        |:..|     ..:.|..:.|.....|.|.  |:||.|...|.:|:::
  Fly    30 LLAFTITPCARNEPLLERCIINA-----AYQIRPLLVHGNLGDGFPTSPLEPLSLDNIELKLSSQ 89

  Fly    71 YLV----------DFTGSIDNFQLHGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKGS 125
            :..          ::||   .:.||         |:|. :|.:|...|:.......|:....:||
  Fly    90 FQAVFKDLEANGGNYTG---KYSLH---------LNLL-LPDIKGKGNMQGYCENAKAFVKIRGS 141

  Fly   126 LAYILNLAGDGNAETSITNFSILISFRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDR-INDF 189
             .|:.|    |......:..:.||.|:            ..:|:|.       ||...|| :.|.
  Fly   142 -RYLRN----GKDYVKFSKMTTLIDFK------------DFKLKLA-------NLFSGDRFLGDV 182

  Fly   190 IHALVNEMGVELLGDV 205
            .::|:|......|.|:
  Fly   183 GNSLINNNQELYLKDI 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 39/188 (21%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 44/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407680
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.