DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG7953

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285913.1 Gene:CG7953 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster

Alignment Length:238 Identity:52/239 (22%)
Similarity:99/239 (41%) Gaps:17/239 (7%)


  Fly    35 FLQEFRMRMCHPIPNLGLPALDPLQLGPAETELN-NKYLVDFTGSIDNFQLHGLSDFDVPALSLS 98
            |:::.:.:|....|..|:|.|.||::.  |.:|: .|.:.:....:...::.||:||::....|:
  Fly    62 FIRKLQKQMECGWPQYGIPVLAPLRIN--EFDLDYKKGIFETLNHVFRLKIAGLNDFNIQKFKLN 124

  Fly    99 PVPG------LKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSI--LISFRLRS 155
            .:..      |...|:.|.......:|..|...|...:...|.|.....:.|..|  .:.::|..
  Fly   125 VITSKITFDFLFKNIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPM 189

  Fly   156 V-SPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQA 219
            : ....|:||:..:.|..:..:....|...:||..|::.:..:.|:.:....|....|:.:.:..
  Fly   190 LWGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAIVP 254

  Fly   220 AVNNFLGQYSLSDIIQIII-GGDGEGESAPIFDGVEPDCKPDA 261
            .||..|.......::.:|: ..|||.|..||.    .||.|.|
  Fly   255 RVNKMLKGKDFWTVVDLILASSDGESEDDPIV----VDCDPSA 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 41/206 (20%)
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 41/208 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.