DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG8997

DIOPT Version :10

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609681.1 Gene:CG8997 / 34799 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster


Alignment Length:241 Identity:65/241 - (26%)
Similarity:118/241 - (48%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALS 96
            |:..::..:.:|.....::|||.|.||::...:..:::..| ...|:||:|:|:||:|||:..:.
  Fly    32 IVDVIEGIKEQMPCGFTSVGLPPLAPLRIDHQDINIDSSVL-KAQGTIDHFRLNGLNDFDIDEMK 95

  Fly    97 LSPVPGLKNTINVTLPLT---------YFKSLYTAKGSLAYILNLAGDGNAETSITNFSI--LIS 150
            ::.:     |..||...|         |..|:...|  ..:.:||.|.|:|:.:|.:..|  .:.
  Fly    96 VNAI-----TSKVTYKFTFRDVNVDTQYDLSVLLKK--YGFTINLIGAGHAKFAIKDMVIWGTMK 153

  Fly   151 FRLRSVS-PLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVEL-LGDVWDYEQGTV 213
            :.|..:| .|.:.||::...||.:....:.::.:..||:.::..:.| .||| :.:..|....|:
  Fly   154 YSLGVISGNLKLKSLEVRTHLGEVDSEIEGILGDGSINEKMNEYLAE-AVELAINENEDLIADTI 217

  Fly   214 VSKVQAAVNNFLGQYSLSDIIQIIIGGDGEGESAPIFDGVEPDCKP 259
            .|....|||:.|...|:::||. ..||||||       |.:..|.|
  Fly   218 ESIALPAVNSVLDDISIAEIIS-GAGGDGEG-------GEKEACIP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:472279 54/211 (26%)
CG8997NP_609681.1 JHBP 21..239 CDD:214779 55/215 (26%)

Return to query results.
Submit another query.