DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG8997

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285912.1 Gene:CG8997 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster

Alignment Length:241 Identity:65/242 (27%)
Similarity:118/242 (49%) Gaps:30/242 (12%)


  Fly    32 ILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALS 96
            |:..::..:.:|.....::|||.|.||::...:..:::..| ...|:||:|:|:||:|||:..:.
  Fly    32 IVDVIEGIKEQMPCGFTSVGLPPLAPLRIDHQDINIDSSVL-KAQGTIDHFRLNGLNDFDIDEMK 95

  Fly    97 LSPVPGLKNTINVTLPLT---------YFKSLYTAKGSLAYILNLAGDGNAETSITNFSI--LIS 150
            ::.:     |..||...|         |..|:...|  ..:.:||.|.|:|:.:|.:..|  .:.
  Fly    96 VNAI-----TSKVTYKFTFRDVNVDTQYDLSVLLKK--YGFTINLIGAGHAKFAIKDMVIWGTMK 153

  Fly   151 FRLRSVS-PLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVEL-LGDVWDYEQGTV 213
            :.|..:| .|.:.||::...||.:....:.::.:..||:.::..:.| .||| :.:..|....|:
  Fly   154 YSLGVISGNLKLKSLEVRTHLGEVDSEIEGILGDGSINEKMNEYLAE-AVELAINENEDLIADTI 217

  Fly   214 VSKVQAAVNNFLGQYSLSDIIQIIIGGDGEGESAPIFDGVEPDCKP 259
            .|....|||:.|...|:::||. ..||||||       |.:..|.|
  Fly   218 ESIALPAVNSVLDDISIAEIIS-GAGGDGEG-------GEKEACIP 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 54/212 (25%)
CG8997NP_001285912.1 JHBP 21..239 CDD:214779 56/216 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.