DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG16820

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster

Alignment Length:201 Identity:37/202 (18%)
Similarity:75/202 (37%) Gaps:39/202 (19%)


  Fly    32 ILAFLQEFRMRMCHP-IPNLGLPALDPLQLGPAETELNNKYLVDFTGS-------IDNFQLHGLS 88
            |...:|.|..::.:. :|...:.::||.        ...:.:..:|..       |.|.:::|:|
  Fly    99 IRGLIQSFAPKLRYQGVPEFNMDSIDPY--------FYKRGIFRYTNDGIQGGLLIKNMEIYGIS 155

  Fly    89 DFDVPALSLSPVP-GLKNTINVTLPLT----YFKSLYTAKGSLAYILNLAGDGNAETSITNF--S 146
            ...|.:::.:... |....:.|.||..    :||:.....|     |.|...|....:|.|.  :
  Fly   156 QLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVKFGG-----LRLVPKGPFNITIDNIKAT 215

  Fly   147 ILISFRLRSV----SPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNE-------MGVE 200
            ||....:..:    ..|::..|...:.:|...:..:.:..:..:|..|..||||       :|:.
  Fly   216 ILTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSDRNLNAMILNLVNENLPEITRVGIP 280

  Fly   201 LLGDVW 206
            ...:.|
  Fly   281 ATREQW 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 37/202 (18%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 37/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406878
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.