DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG5945

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster

Alignment Length:126 Identity:27/127 (21%)
Similarity:44/127 (35%) Gaps:26/127 (20%)


  Fly   135 DGNAETSITNFSILISFRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGV 199
            |||.|           .|:....||.::....:...|  .:|....:...:|..|......|:.|
  Fly    55 DGNPE-----------LRIEPYEPLHLNRTSFQYSSG--TVNGRITVRNAKIYGFSSNRAKEVSV 106

  Fly   200 ELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLS-DIIQIIIGGDGE-------GESAPIFDG 252
            :|.||.......|.:.|:     |.:|.|... .:.|:.:...||       .|:..:.||
  Fly   107 KLNGDKVKLRLVTQMPKL-----NIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDG 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 21/96 (22%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406771
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.