DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG5945

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001260439.1 Gene:CG5945 / 34729 FlyBaseID:FBgn0032494 Length:250 Species:Drosophila melanogaster


Alignment Length:126 Identity:27/126 - (21%)
Similarity:44/126 - (34%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 DGNAETSITNFSILISFRLRSVSPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGV 199
            |||.|           .|:....||.::....:...|  .:|....:...:|..|......|:.|
  Fly    55 DGNPE-----------LRIEPYEPLHLNRTSFQYSSG--TVNGRITVRNAKIYGFSSNRAKEVSV 106

  Fly   200 ELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLS-DIIQIIIGGDGE-------GESAPIFDG 252
            :|.||.......|.:.|:     |.:|.|... .:.|:.:...||       .|:..:.||
  Fly   107 KLNGDKVKLRLVTQMPKL-----NIVGSYKADMQVNQLQLKPKGEFNVTLLDVEAITVTDG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 21/95 (22%)
CG5945NP_001260439.1 JHBP 22..249 CDD:214779 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.