DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG5867

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster

Alignment Length:200 Identity:45/200 (23%)
Similarity:79/200 (40%) Gaps:47/200 (24%)


  Fly    36 LQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPV 100
            ||:...||.:.|..|.:|.|||.::|.:.....:. |:....|:.|..:||||:           
  Fly    57 LQQITPRMKYGISELNIPPLDPFEMGKSSYSYTSG-LLQGRISMKNVVIHGLSE----------- 109

  Fly   101 PGLKNTINVTL-------------PLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR 152
             |:.:.:|..|             |..:.:.||.|...| ..|.|...|....::|:    ::.|
  Fly   110 -GIVDKVNFRLKDGRVRMEILSHVPQMFVEGLYKADIKL-NDLKLNPKGAFNITMTD----VAMR 168

  Fly   153 LRSVSP---------LAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLG----- 203
            .|.:..         |.::.|:.|.::|.|....:.|:.:..:||.|...:|:...:|..     
  Fly   169 ARPIGELYERDGHTYLRLTKLETEPKVGDLKFYANGLVPDPVLNDVILDFINQYWRQLYQAMLPE 233

  Fly   204 --DVW 206
              |.|
  Fly   234 TLDTW 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 45/200 (23%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406899
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.