DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG3246

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster

Alignment Length:250 Identity:48/250 (19%)
Similarity:90/250 (36%) Gaps:40/250 (16%)


  Fly    30 AKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPA 94
            |::.|.|..|:......:|  |:|..|||::...:..:....|     .:...:.:|||.|.:..
  Fly    51 AQVEAMLVHFQQEDPQGLP--GVPVPDPLEVPNVKKSMGMANL-----DMKQVKAYGLSKFRIDK 108

  Fly    95 LSLSPVPGLKNTINVTLPLTYFKSLYT-------AKGSLAYILNLAGDGNAETSITNFSILISFR 152
            ::|. :..::....:.|.....|..||       |.|....:|.     |.....|.|     ..
  Fly   109 MNLD-LKEMRFNGGLQLDQMLVKGQYTLSSFFSKANGPFTVVLK-----NVYAEATAF-----LA 162

  Fly   153 LRSVSPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLGDVWDYEQGTVV--- 214
            :.....||...::|::....:.::|.||   ..:.....::||  |...|  |:|..:..::   
  Fly   163 VERDGQLATDRIKIDITFSDMTMDFQNL---GLVGSVFQSVVN--GAPNL--VFDAMKPFMLQEA 220

  Fly   215 -----SKVQAAVNNFLGQYSLSDIIQIIIGGDGEGESAPIFDGVEPDCKPDATTT 264
                 |::...:...||:..|.:.|..:..............|.:|...||...|
  Fly   221 DKKLRSEINVMIQKTLGERRLPNSITPLDSAIAMARKMVRQKGFDPYHLPDVNRT 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 41/214 (19%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 43/220 (20%)
Grp7_allergen 260..418 CDD:293589 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1406491
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.