DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG31207

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster

Alignment Length:186 Identity:32/187 (17%)
Similarity:69/187 (37%) Gaps:60/187 (32%)


  Fly   103 LKNTINVTLPLTYFKSLYTAKGS-LAYILNLAGDGNAETSITNFSILISFRLRSVSPLAISSLQI 166
            :|:||.|.:.|....||   :|. |...:.....|:::..:.:.:.:|....:.:..:.:..:.:
  Fly     1 MKDTIIVLVLLQIIGSL---QGQILPKEIKKCRFGDSKCIVNSMNAIIKNYPKGIPAIGLKPIDV 62

  Fly   167 ----------ELRLGGLWINFD--------------------------NLMEEDRINDFIHALVN 195
                      :..:|..|:|||                          :|:|   |:..|.:|::
  Fly    63 VDIRDSKFWNDAMVGAFWLNFDLFNQVNYGFENTTITKVSGFDENPTSSLIE---IHGRIPSLIH 124

  Fly   196 EMGVELLGDVW------------DYEQGTVVSKVQAAV---NN--FLGQYSLSDII 234
            :.....:|.||            |::....|.|::..:   ||  :|..|.|:..:
  Fly   125 KGDYFSMGRVWIVQMNSTGESLSDFQNFRFVLKLKVIMEYRNNKRYLKIYELTPFV 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 32/182 (18%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 29/181 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407350
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.