DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG2650

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:CG2650 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster

Alignment Length:234 Identity:45/235 (19%)
Similarity:90/235 (38%) Gaps:56/235 (24%)


  Fly    29 EAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETEL-NNKYLVDFTGSIDNFQLHGLSDFDV 92
            |:.:||..|.|.....:.||...:.||:|:.||....|. .:...:.|..::.:.:|:.|::   
  Fly    41 ESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESGGHSESIKFKLTMSDAKLYNLAN--- 102

  Fly    93 PALSLSPVPG--------LKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILI 149
             ::.:..:.|        ||.|:.:..|....::.|...|.| .||.:...|:           :
  Fly   103 -SMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAKYDVDGKL-LILPIVSKGD-----------L 154

  Fly   150 SFRLRSV-----------------SPLAISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNE 196
            :.||..|                 :.|.|:..:...::.|...:..||..::: :.|....::|:
  Fly   155 TIRLNDVHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDNKELRDSTLKVLNQ 219

  Fly   197 MGVELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLSDIIQ 235
                        |..|:...||..:|....: :.|.|:|
  Fly   220 ------------EWSTLALDVQPKINEACAK-AFSAIVQ 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 41/226 (18%)
CG2650NP_570016.1 JHBP 29..258 CDD:214779 45/235 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1407710
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.