DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34316 and CG33306

Sequence 1:NP_001097798.1 Gene:CG34316 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster

Alignment Length:258 Identity:60/259 (23%)
Similarity:117/259 (45%) Gaps:36/259 (14%)


  Fly     6 LTSQVLLATAI-LYAC--------LSPAACVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQLG 61
            :.|..|:|..: |.:|        ||.....:.:.|:..|:.||:.:.:..|..|:|.:.|::..
  Fly     1 MKSAFLIALIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAA 65

  Fly    62 PAETELNNKYLVDFTGS--IDNFQLHGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKG 124
            ....|:|:.   :|:|:  ::||:|.||..:::..:::..:.. :.|.|:......|.:.|....
  Fly    66 QRSFEINSG---EFSGTFGVENFELQGLDQYEIITMNMDVIRS-RLTFNINFASLNFTTDYEMDM 126

  Fly   125 SLAYILNLAGDGNAETSITNFSI--LISFRLR-SVSPLAISSLQIELRLGGLWINFDNLME---- 182
            ...|  .:..:|.|..::.:.:|  .||:.|. ..|.|.:..:.|...:|.:....:||.:    
  Fly   127 GSGY--RIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIF 189

  Fly   183 ----EDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLSDIIQIIIGGD 241
                .:.|.:|:...:|| ..:.:. .|..||.|.:      .|:.:|..:|||||.||.||:
  Fly   190 NRKLNEIIEEFVTLTINE-NTDFVA-AWVSEQATPI------CNDLIGDRTLSDIIAIITGGN 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 45/212 (21%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 47/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.