DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1galt1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 MGIID:2151071 Length:363 Species:Mus musculus

Alignment Length:250 Identity:77/250 (31%)
Similarity:123/250 (49%) Gaps:32/250 (13%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYL--------- 62
            |....||:||.||.:.||.:||:|.:.:.:.    |.:.     ...::|..|.|.         
Mouse    99 NLEKKAKHVKATWAQRCNKVLFMSSEENQDF----PTVG-----LKTKEGREQLYWKTIKAFQYV 154

  Fly    63 --FYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVIS 125
              .|.:..|||::.:..::|:::|||:::  .||.|.||||||...:..| .:.::...:|||:|
Mouse   155 HDHYLEDADWFMKADDDTYVIVDNLRWLL--SKYNPEQPIYFGRRFKPYV-KQGYMSGGAGYVLS 216

  Fly   126 REALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLN 190
            :|||||:..|.|   .::||| ...:|.|.:.||:...||...:|||....|||.|...::..:.
Mouse   217 KEALRRFVNAFK---TEKCTH-SSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIK 277

  Fly   191 GYDTIP---WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            ||  :|   |....:|:...|.....|..|:.|.......||:..|.||.|:.:|
Mouse   278 GY--LPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYG 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 49/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88712967
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.