DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and AT5G57500

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_200558.1 Gene:AT5G57500 AraportID:AT5G57500 Length:318 Species:Arabidopsis thaliana

Alignment Length:180 Identity:44/181 (24%)
Similarity:75/181 (41%) Gaps:33/181 (18%)


  Fly    43 VINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELE 107
            :.|.||.     |.....|:..||. |.::|:|.    ::.:||.:       |.:.:|:||.:.
plant   155 IFNETDA-----QKPPYHYVMKADD-DTYIRLES----LVASLRPL-------PREDLYYGYVIP 202

  Fly   108 NIVTHESFVHHHS--GYVISREA---LRRYTMASK---DPENKECTHW--EGYVEGLDIHRCLRF 162
             ..:.:.|||:.|  ||::|.:.   |:...:..|   .||:|....|  ||. .|.:.... ::
plant   203 -CPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWIREGR-RGKNRFNA-KW 264

  Fly   163 ANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVP 212
            :.....|......||.: |.|:....|...:  .|:|.|:|...|....|
plant   265 SMYNFPEPPTRCTHELW-PDTIAVHLLKNQE--KWIRTLNYFNVTSNLKP 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
AT5G57500NP_200558.1 Galactosyl_T 83..225 CDD:304462 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.