DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and b3glct

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_012812732.1 Gene:b3glct XenbaseID:XB-GENE-951583 Length:530 Species:Xenopus tropicalis

Alignment Length:226 Identity:46/227 (20%)
Similarity:85/227 (37%) Gaps:68/227 (30%)


  Fly    10 DTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTL----VQQG-------LMQAYL- 62
            |....||:||.|......:.|...|          |:..|..|    |::|       :::.:: 
 Frog   316 DRVPVVKKTWEKQATHYEYYSDYAD----------NTIPTADLRIPNVERGHCGKTFAILERFME 370

  Fly    63 FYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIY----FGYELE----NIVTHESFVHHH 119
            .|..::.|.:.|:..:.:.|..|:.::  ..|.|.|.::    :||.|:    |.:|      ..
 Frog   371 LYVGRMSWLIIVDDDTLISLPRLQKLL--GCYNPHQAVFLGERYGYGLQAGGYNYIT------GG 427

  Fly   120 SGYVISREALRRYTMASKDPENKECTHWEGYV-EGLDIHRCLRFANVTVAES------------R 171
            .|.|.||||:||..       |.:|..:.... :.:.:..|.....:|:..|            :
 Frog   428 GGMVFSREAVRRLM-------NSKCRCYSNDAPDDMVLGMCFSSLGITITHSPLFHQARPTDYAK 485

  Fly   172 DEFEHETFL---------PVTMDYQFLNGYD 193
            |...|:..:         |:.:.|::| |.|
 Frog   486 DYLAHQIPISFHKHWNIDPIKVYYKWL-GQD 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
b3glctXP_012812732.1 Fringe 298..501 CDD:190308 41/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.