DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1GALT1C1L

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001094800.1 Gene:C1GALT1C1L HGNCID:51617 Length:315 Species:Homo sapiens

Alignment Length:247 Identity:69/248 (28%)
Similarity:107/248 (43%) Gaps:33/248 (13%)


  Fly    15 VKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLF--YADQIDWFLRVEPS 77
            :|.||.|||:.........|....     |.|.|.|  ||......|:|  |.|..:||....|:
Human    87 LKETWTKHCDKAELYDTKNDNLFN-----IESNDRW--VQMRTAYKYVFEKYGDNYNWFFLALPT 144

  Fly    78 SFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPEN- 141
            :|.|:|||:|::..|  ..|||.|.|:.:  |.....:|....|.|:|||.::|......:.|. 
Human   145 TFAVIENLKYLLFTR--DASQPFYLGHTV--IFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETC 205

  Fly   142 -KECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP--WLRKLSY 203
             .:...|: ..|...:..||::|.|. ||:.:            ||:..:.::|.|  .|.:.:.
Human   206 ADQSVIWK-LSEDKQLAICLKYAGVH-AENAE------------DYEGRDVFNTKPIAQLIEEAL 256

  Fly   204 HKRTEKTVP--ISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 253
            ....::.|.  .|..||.|....|.:|....|.:|||:.||....:::.|.|
Human   257 SNNPQQVVEGCCSDMAITFNGLTPQKMEVMMYGLYRLRAFGHYFNDTLVFLP 308



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88723538
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.