DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1galt1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006236153.1 Gene:C1galt1 RGDID:621105 Length:390 Species:Rattus norvegicus

Alignment Length:250 Identity:77/250 (31%)
Similarity:122/250 (49%) Gaps:32/250 (13%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYL--------- 62
            |....||:||.||.:.||.:||:|.:.:.:.    |.:...     .::|..|.|.         
  Rat   126 NLEKKAKHVKATWAQRCNKVLFMSSEENKDF----PTVGLE-----TKEGREQLYWKTIKAFQYV 181

  Fly    63 --FYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVIS 125
              .|.:..|||::.:..::|:|:|||:::  .||.|.||||||...:..| .:.::...:|||:|
  Rat   182 HDHYLEDADWFMKADDDTYVILDNLRWLL--SKYNPEQPIYFGRRFKPYV-KQGYMSGGAGYVLS 243

  Fly   126 REALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLN 190
            :|||||:..|.|   .::||| ...:|.|.:.||:....|...:|||....|||.|...::..:.
  Rat   244 KEALRRFVDAFK---TEKCTH-SSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIK 304

  Fly   191 GYDTIP---WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            ||  :|   |....:|:...|.....|..|:.|.......||:..|.||.|:.:|
  Rat   305 GY--LPKTFWYWNYNYYPPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYG 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C1galt1XP_006236153.1 Galactosyl_T 134..>275 CDD:304462 50/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88713217
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.