DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1galt1c1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_067525.1 Gene:C1galt1c1 MGIID:1913493 Length:316 Species:Mus musculus

Alignment Length:268 Identity:72/269 (27%)
Similarity:112/269 (42%) Gaps:71/269 (26%)


  Fly    15 VKRTWGKHC---------NVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDW 70
            ||.||.|||         ||.:|.|.::|           :.|.|.::::....||..|.||.:|
Mouse    84 VKETWTKHCDKAEFFSSENVKVFESINMD-----------TNDMWLMMRKAYKYAYDQYRDQYNW 137

  Fly    71 FLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGY-----ELENIVTHESFVHHHSGYVISREALR 130
            |....|::|.|:|||:|.:.|:  ..|||.|.|:     :||       :|....|.|:|.|:::
Mouse   138 FFLARPTTFAVIENLKYFLLKK--DQSQPFYLGHTVKSGDLE-------YVSVDGGIVLSIESMK 193

  Fly   131 RYTMASKDPENKECTHWEGYV----EGLDIHRCLRFA-----NVTVAESRDEFEHET---FLPVT 183
            |.......||  :|....|.:    |...:..||::|     |...|:.:|.|..::   |:...
Mouse   194 RLNSLLSVPE--KCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEA 256

  Fly   184 M---DYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 245
            |   ..|.:.|.                    .|..|:.|....|.:|:...|.||||:.||...
Mouse   257 MTNQPNQVVEGC--------------------CSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVF 301

  Fly   246 RNSIDFRP 253
            .:::.|.|
Mouse   302 NDALVFLP 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88723133
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.