DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG34452

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster

Alignment Length:249 Identity:88/250 (35%)
Similarity:130/250 (52%) Gaps:14/250 (6%)


  Fly     4 YNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQI 68
            |.|.....|.::.|||.:||:..||||.|||..|||.| .:|..|.|..::..|...|.::..|.
  Fly    61 YAYRHGHAAIHIHRTWVRHCDHYLFVSDDIDNHLEPAV-FMNMPDKWHRMRAYLEYVYKYHFHQG 124

  Fly    69 DWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYEL---ENIVTHESFVHHHSGYVISREALR 130
            ||||.....:|||::|||:|:  :.|.|.:.||||.:|   ..:|    |:...||.|.|..||:
  Fly   125 DWFLYCNDDNFVVVDNLRHML--KTYSPKELIYFGCKLRTTNGLV----FMLEGSGIVFSAAALK 183

  Fly   131 RYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQF---LN-G 191
            |:.:.:...|:...:..:|.....::.|||...||...:|||||:...|||...|...   :| .
  Fly   184 RFALTALTNESICSSETKGNDFTKELGRCLTNVNVIAGDSRDEFQRHRFLPFDADLHLGSSMNES 248

  Fly   192 YDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 245
            .:...:....||:...:..:|:|..:|||.|.|...:||.|||.|:.:|||.|:
  Fly   249 LENHKYFLDHSYYPVNDMNLPVSLHSICFHVPYTLNIYDLYYFAYKTRIFGVPL 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 48/118 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88692639
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.