DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC564281

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_692721.4 Gene:LOC564281 ID: Length:341 Species:Danio rerio

Alignment Length:255 Identity:74/256 (29%)
Similarity:116/256 (45%) Gaps:38/256 (15%)


  Fly    13 KYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTL---VQQGLMQAY-----------LF 63
            ::|..||.:|||::|::|.             .|:|..|:   |.:|..|.|           ..
Zfish    95 QHVNATWAQHCNLVLYMSS-------------QSSDFPTVGLNVSEGRSQLYWKTIRAFQHIQKH 146

  Fly    64 YADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREA 128
            :....||||:.:..:|||||||||::  .::...:|:|||::....| .:.::...:|||:||||
Zfish   147 HLQHADWFLKADDDTFVVLENLRYLL--SQHDTEKPLYFGHKFRPFV-RQGYMSGGAGYVLSREA 208

  Fly   129 LRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYD 193
            |||:....   ....|||:.. :|.:.:.||:....|...::||....|||.|...|...::..:
Zfish   209 LRRFVQGF---VTGRCTHFSS-LEDMALGRCMEIMGVKAVDTRDANLRETFNPFWPDKHLIHKDN 269

  Fly   194 TIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 253
            |.......||:|........|...|.|......:||...|:.|.|:.||...|    |.|
Zfish   270 TKKQDSLYSYYKTKLGPECCSDFVISFHYLRAADMYMLEYYTYHLRPFGYKYR----FNP 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
LOC564281XP_692721.4 Galactosyl_T <153..>244 CDD:304462 34/98 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.