DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and c1galt1a

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio

Alignment Length:252 Identity:79/253 (31%)
Similarity:117/253 (46%) Gaps:31/253 (12%)


  Fly     3 PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDID------------GELEPYVPVINSTDTWTLVQQ 55
            |.|..|  .|::||.||.:||||:||:|.:.|            |..:.|         |..: :
Zfish   102 PSNLQS--KAQHVKNTWSRHCNVVLFMSSEEDRSFPTVGLGTGEGRDQLY---------WKTI-R 154

  Fly    56 GLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHS 120
            ....|...:..:.||||:.:..:|||::|||:::  ..|.|.||||||...:. .|.:.::...:
Zfish   155 AFHYALKNHGHEADWFLKADDDTFVVVDNLRWIL--SNYTPEQPIYFGKRFKP-YTKQGYMSGGA 216

  Fly   121 GYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMD 185
            |||:|:|||||:.   :....|.|||... ||.|.:.:||....|...:|||....|||.|...:
Zfish   217 GYVLSKEALRRFV---EGFSTKVCTHTTP-VEDLAMGQCLEKMGVLAGDSRDSLHRETFHPFIPE 277

  Fly   186 YQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            :.....:....|.....|:...|.....|..|:.|....|..||...|:.|.|:.||
Zfish   278 HHLTGKFSKTFWYWNYCYYPIVEGPQCCSDLAVSFHYVDPVLMYTLEYYTYHLRPFG 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 45/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.