DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and si:dkey-202e17.1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_005170092.1 Gene:si:dkey-202e17.1 ZFINID:ZDB-GENE-060503-810 Length:316 Species:Danio rerio

Alignment Length:266 Identity:74/267 (28%)
Similarity:115/267 (43%) Gaps:41/267 (15%)


  Fly     3 PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTL---VQQGLMQAY--- 61
            |.|..|  ..::|..||||.|:.:|:::.             .:||..|:   |.:|..|.|   
Zfish    73 PQNLQS--RTQHVHATWGKRCDTILYMTS-------------KNTDFPTIGLNVSEGRNQLYWKT 122

  Fly    62 --------LFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHH 118
                    ..:.|..||||:.:..:|||:||||:.:  .|:....|:|||......|. :.::..
Zfish   123 IRAFQYIHKHHLDDADWFLKADDDTFVVIENLRHSL--SKHSSEDPLYFGRRFRPFVA-QGYMSG 184

  Fly   119 HSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVT 183
            .:|||:|:|||||:.....|   ..||| ...:|.:.:.:|:....|.:.:|||.|..:.|.|..
Zfish   185 GAGYVLSKEALRRFVKGFAD---GLCTH-TTELEDVGMGQCMEKMKVEMGDSRDVFGRQVFHPYP 245

  Fly   184 M-DYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRN 247
            . :|.........||.....::...|.....|..||.|......||:...|:.|.|:.:|...| 
Zfish   246 PGNYLVRQLRRQRPWYLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYGYKYR- 309

  Fly   248 SIDFRP 253
               |.|
Zfish   310 ---FNP 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
si:dkey-202e17.1XP_005170092.1 Galactosyl_T <139..>229 CDD:304462 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.