DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and T09E11.12

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001076611.1 Gene:T09E11.12 WormBaseID:WBGene00045103 Length:323 Species:Caenorhabditis elegans

Alignment Length:182 Identity:40/183 (22%)
Similarity:78/183 (43%) Gaps:36/183 (20%)


  Fly    15 VKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYL---------FY------ 64
            :..||.:.|:         :|......|::|...|::.|.:.|..:|.         ||      
 Worm    98 IASTWLRRCD---------NGRFFSKTPLLNLNITYSTVYKNLEDSYSDLFRKSIFGFYYSYVHI 153

  Fly    65 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREAL 129
            :...||:|:.:..::..:::||..::  ...||:|:|.||:       ..:....|||::|..|:
 Worm   154 SKSFDWYLKADDDTYFAMDHLREYLN--TLDPSKPLYLGYK-------NGYNSGGSGYILSNAAV 209

  Fly   130 RRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLP 181
            :.:...|...| ..|.:  .:.|...|.|||....:...::||:....:|:|
 Worm   210 KLFVEKSYHDE-YGCPY--DWAEDHGIGRCLARVGIYPTDTRDDKGLNSFVP 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
T09E11.12NP_001076611.1 Galactosyl_T <130..246 CDD:304462 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734927
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.