DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and c1galt1c1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis

Alignment Length:248 Identity:64/249 (26%)
Similarity:118/249 (47%) Gaps:31/249 (12%)


  Fly    15 VKRTWGKHCNVLLFVSGDIDGELEPYVPV-INSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSS 78
            |:.||.|||:...:.|.:   .::.:..: :::.|.|.::::.:...|....:..:||....||:
 Frog    85 VRETWSKHCDKADYYSSE---PMKVFESISVDTNDLWAMMRKAIQMTYENNKNAYNWFFICTPST 146

  Fly    79 FVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKE 143
            |.|:|||:|.:.::  .||||.|.|:.:::  ....:|....|.|:|.|:|.|.....|:||  :
 Frog   147 FAVIENLKYFLLQK--DPSQPYYLGHTVKS--GDLDYVDIAGGIVLSIESLHRLFSIFKEPE--K 205

  Fly   144 CTHWEGYV----EGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDT--IPWLRKLS 202
            |....|.:    |...:..||::..| :||:.::.|.:            |.::|  :..|.:.:
 Frog   206 CPEQGGLIFKMSEDKQLAMCLKYKGV-LAENAEDSEGK------------NVFNTKSVGTLIQET 257

  Fly   203 YHKRTEKTVP--ISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 253
            .....:|.|.  .|..||.|....|..|:...|.||||:.:|....:::.|.|
 Frog   258 MANNPQKVVEGCCSDMAITFSGISPNFMHVMMYGVYRLRAYGHSFNDALVFHP 310



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88722835
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.