DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG34057

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster

Alignment Length:258 Identity:73/259 (28%)
Similarity:128/259 (49%) Gaps:34/259 (13%)


  Fly    12 AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDT----WTLVQQGLMQAYLFYADQIDWFL 72
            |..|.||||..||.|:|:|...|..|.  :..||.:::    :..|:.|:...:..|.::.||||
  Fly    97 AALVNRTWGARCNKLIFMSSQTDSNLN--ILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFL 159

  Fly    73 RVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASK 137
            :.:..:::|:||||..::  .|.|...:|||...:...: :.::....|||:||:||||..:.:.
  Fly   160 KADDDTYIVMENLRLFLY--PYDPESSVYFGCRFKAYFS-QGYMSGGGGYVLSRDALRRLNLFAL 221

  Fly   138 DPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP------ 196
            :  :.......|..|.:.|..||:...|...::||...|..||||       |.:...|      
  Fly   222 N--STTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPV-------NPFTVFPTILSNS 277

  Fly   197 WLRKLSYHKRTEKTVPISSRAICF--LVEYPPEMYDYYYFVYRLKIFG---TP--VRNSIDFR 252
            ||....:|| ..|:...::.||.|  :.::..|:::  :|:|.:::||   ||  :.:.:.||
  Fly   278 WLEGYFFHK-PNKSDCCAASAISFHYVKDFEFELFE--FFLYYMRVFGLHRTPRALPSRLGFR 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289151
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.