| Sequence 1: | NP_001369052.1 | Gene: | CG34451 / 5740612 | FlyBaseID: | FBgn0085480 | Length: | 307 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001033980.2 | Gene: | CG34057 / 3885645 | FlyBaseID: | FBgn0054057 | Length: | 355 | Species: | Drosophila melanogaster | 
| Alignment Length: | 349 | Identity: | 94/349 - (26%) | 
|---|---|---|---|
| Similarity: | 164/349 - (46%) | Gaps: | 62/349 - (17%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     3 SPRRV---YYGLFLAL---ILFLILTLYINVSEVD-------------RKPAK--------RSNQ 40 
  Fly    41 HTLDPLYEEIRILCMIPYNYNSPDT-AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDT- 103 
  Fly   104 ---WTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVT 165 
  Fly   166 HESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEH 230 
  Fly   231 ETFLPVTMDYQFLNGYDTIP------WLRKLSYHKRTEKTVPISSRAICF--LVEYPPEMYDYYY 287 
  Fly   288 FVYRLKIFG---TP--VRNSIDFR 306  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG34451 | NP_001369052.1 | None | |||
| CG34057 | NP_001033980.2 | Galactosyl_T | 93..>243 | CDD:304462 | 46/156 (29%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2246 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1407357at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000473 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23033 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.920 | |||||