DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG34056

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster

Alignment Length:247 Identity:77/248 (31%)
Similarity:133/248 (54%) Gaps:14/248 (6%)


  Fly     2 IPYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGEL---EPYVPVINSTDTWTLVQQGLMQAYLF 63
            :|.|:.|  ..:.||.|||:.||.|:|:|...|.||   :..||. :..:.:..:::.|...|..
  Fly    70 LPKNHQS--RVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE-DRNNLYLKMRKALEYVYRN 131

  Fly    64 YADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREA 128
            :.:..||||:.:..:||::||||::::  .|.|...:|||:....... :.::...:|||:||:|
  Fly   132 HGEDYDWFLKADDDTFVIMENLRFLLY--PYDPEAALYFGHRFRTTFP-QGYMSGGAGYVMSRDA 193

  Fly   129 LRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYD 193
            |||..:.:.:  |.:........|...|..||:...|...:||||...:.|||:::.: .|..:.
  Fly   194 LRRLNLFAFN--NSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKF-MLPTFP 255

  Fly   194 TIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 245
            |..||.||::::...:|...|..:..::..:..|||:  |.:|||.|||||:
  Fly   256 TDNWLPKLTFYEPVNETGSTSGISFHYVKIHEFEMYE--YLLYRLHIFGTPL 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 49/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699635
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.