DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG8708

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_610360.2 Gene:CG8708 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster

Alignment Length:252 Identity:78/253 (31%)
Similarity:119/253 (47%) Gaps:33/253 (13%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI------NSTDTWTLVQQGLMQAYLFYA 65
            |....|::|||||||.||:|||:|...|.||    |.:      ...:.|..|::.....|..:.
  Fly   106 NHKKKARHVKRTWGKRCNILLFMSSGADEEL----PTVKLDVGEGRENLWAKVKEAFKYVYHHHY 166

  Fly    66 DQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALR 130
            :..|:|.:.:..::.|:||:|||::  .|.|..|::||::.:..| .:.::...:||::||||||
  Fly   167 NDADFFYKADDDTYAVIENMRYMLY--PYNPETPVHFGFKFKPFV-KQGYMSGGAGYILSREALR 228

  Fly   131 RYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEF----------EHETFLPVTMD 185
            |:.:.. .|..|.|.......|.::|.||:...|||..:||||.          ||. .:|...|
  Fly   229 RFVVEG-IPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFPFIPEHH-LIPAKAD 291

  Fly   186 YQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            ..|        |.....|:|..:.....|..||.|....|...|...|.:|.||.:|
  Fly   292 KNF--------WYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYG 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88692586
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.