DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1GalTA

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster

Alignment Length:250 Identity:78/250 (31%)
Similarity:128/250 (51%) Gaps:9/250 (4%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPY-VPV-INSTDTWTLVQQGLMQAYLFYADQID 69
            |....|::|||||||.||.|:|:|...|.||:.. :|| ....:.|...::.....|..:.:..|
  Fly   111 NHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDAD 175

  Fly    70 WFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTM 134
            |||:.:..::.::||:|||::  .|.|..|:|||.:.:..| .:.::...:|||:||||:||:.:
  Fly   176 WFLKADDDTYTIVENMRYMLY--PYSPETPVYFGCKFKPYV-KQGYMSGGAGYVLSREAVRRFVV 237

  Fly   135 ASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGY-DTIPWL 198
            .:. |..|.|.......|.::|.:||:..||...:|||......|.|...::..:..: |...|.
  Fly   238 EAL-PNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFWY 301

  Fly   199 RKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSIDFRP 253
            .:..::|..|.....|..||.|....|.:||...|.:|.|:.:|  :.|:.|..|
  Fly   302 WQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYG--IINTPDALP 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 51/150 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88692522
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.