DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG9109

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster

Alignment Length:97 Identity:20/98 (20%)
Similarity:44/98 (45%) Gaps:23/98 (23%)


  Fly    48 DTWTLVQ---QGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHK-RKYQPSQPIYFGYELEN 108
            ::||::.   ....||.:..| :.:|.:..:.::.|  .:||.::.: |:..|.:..::|:.|.:
  Fly    80 NSWTMLDALPHLRAQARVLGA-RTEWIIWCQHNTRV--SSLRGLLEQLRRQNPRELAFYGHALYD 141

  Fly   109 IVTHESFVHHHSGYVISREALRRYTMASKDPE 140
              ...:.:||.|.|              |||:
  Fly   142 --AEATIIHHFSNY--------------KDPQ 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG9109NP_001285650.1 Fringe 269..486 CDD:190308
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.