DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and c1galt1b

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio

Alignment Length:248 Identity:70/249 (28%)
Similarity:123/249 (49%) Gaps:21/249 (8%)


  Fly     9 PDT----AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI--NSTDTWTLVQQGLMQAYLF---- 63
            ||.    |::||.||.:|||:::|:| .:|   .|..|.:  |:.:....:....::|:.:    
Zfish    97 PDNLEKKARHVKATWSRHCNIVVFIS-SVD---NPDFPTVGLNTKEGRDQLYWKTIRAFHYVMEK 157

  Fly    64 YADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREA 128
            ::|:.||||:.:..::|:::|||:::  .::.|..|:|||...:..| .:.::...:|||:|:||
Zfish   158 HSDEADWFLKADDDTYVIVDNLRWIL--ARHSPEDPVYFGRRFKPYV-KQGYMSGGAGYVLSKEA 219

  Fly   129 LRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYD 193
            |||:....:   .|.|||... ||.|.:.:|:....|...:|||..:.|||.|...:......:.
Zfish   220 LRRFVEGFR---TKVCTHTTS-VEDLAMGQCMEKIGVKAGDSRDTMQRETFHPFVPESHLTGTFP 280

  Fly   194 TIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVR 246
            ...|.....|:...:.....|..|:.|.......||...|:.|.|:.||...|
Zfish   281 KTFWYWNYCYYPIVQGPQCCSDLAVSFHYVDASHMYLLEYYTYHLRAFGYKYR 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 54/178 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.