DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG2983

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608723.2 Gene:CG2983 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster

Alignment Length:254 Identity:70/255 (27%)
Similarity:105/255 (41%) Gaps:39/255 (15%)


  Fly     4 YNYNSP----DTAKYVKRTWGKHCNVLLFVS--------GDIDGELEPYVPVINSTDTWTLVQQG 56
            |.|..|    ..|:.|..|||:.||.|:|.|        |.::..:.||.     .::|...:..
  Fly    78 YVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYF-----RESWLKTKMA 137

  Fly    57 LMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSG 121
            |...:..:.:..||||..:..::||:||||||::  .|.|...||||               ..|
  Fly   138 LKYLHDHHLNDADWFLEADDETYVVMENLRYMVY--PYSPQLAIYFG---------------SPG 185

  Fly   122 YVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRD-EFEHETFL--PVT 183
            .|:||.||||....|. |...:|...........:..||...||....:.| |.....:|  |..
  Fly   186 TVMSRAALRRLVELSL-PNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQA 249

  Fly   184 MDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            ....||: ||:..|..|...::..:.....|:.|:.|.......::.:.|.:|||:.||
  Fly   250 RSNLFLH-YDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFG 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289172
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.