DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and CG2983

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster


Alignment Length:306 Identity:85/306 - (27%)
Similarity:132/306 - (43%) Gaps:51/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILFLILTLYIN--VSEVDRKPAKRSNQHT--------LD-PLYEEIRILCMI---PYNYNSPDTA 66
            :|||:|.:.|.  :::|...|......||        || .|.:|:|:||.:   |.|:.:  .|
  Fly    28 VLFLLLGIGIGYLITKVLVWPIMDLKSHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKT--QA 90

  Fly    67 KYVKRTWGKHCNVLLFVS--------GDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQID 123
            :.|..|||:.||.|:|.|        |.::..:.||.     .::|...:..|...:..:.:..|
  Fly    91 QAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYF-----RESWLKTKMALKYLHDHHLNDAD 150

  Fly   124 WFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTM 188
            |||..:..::||:||||||::  .|.|...||||               ..|.|:||.||||...
  Fly   151 WFLEADDETYVVMENLRYMVY--PYSPQLAIYFG---------------SPGTVMSRAALRRLVE 198

  Fly   189 ASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRD-EFEHETFL--PVTMDYQFLNGYDTIP 250
            .|. |...:|...........:..||...||....:.| |.....:|  |......||: ||:..
  Fly   199 LSL-PNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLH-YDSNI 261

  Fly   251 WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 296
            |..|...::..:.....|:.|:.|.......::.:.|.:|||:.||
  Fly   262 WFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.