DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG18558

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608720.2 Gene:CG18558 FlyBaseID:FBgn0031469 Length:588 Species:Drosophila melanogaster

Alignment Length:257 Identity:67/258 (26%)
Similarity:120/258 (47%) Gaps:38/258 (15%)


  Fly     3 PYNYNSPDTAKYVKRTWGKHCNVLLF--------VSG-DIDGELEPYVPVINSTDT----WTLVQ 54
            |..|.|  .|:.:..|||:|||.:::        :|| :|.|        :|::||    |...:
  Fly   330 PKKYMS--GARAISETWGRHCNRVIYYGSFPGTTISGLEIVG--------LNASDTRSKLWGKTK 384

  Fly    55 QGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFG--YELENIVTHESFVH 117
            .....||..|..::|||.:.:..::.|:||:|.::  :.|.||.|||||  ::|.:.:    ::.
  Fly   385 AAFRHAYRNYGHEVDWFYKADDDTYAVMENMRKLL--KPYSPSNPIYFGSPFKLGSTL----YMS 443

  Fly   118 HHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPV 182
            ..:|||:|:.|:....:.:.:.........|.||.|    :||....|...:|||....:.|..:
  Fly   444 GGAGYVLSKSAVELLNLGAAENCQPGDQGTEDYVMG----KCLSLLQVQAGDSRDLLGRQRFFSL 504

  Fly   183 TMDYQFL--NGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            :::: ||  |..|...||::..|..........|:.:|......|.||:.....:|:.:.:|
  Fly   505 SLEH-FLIPNRDDEGFWLQEYLYQTTGTGLECCSTYSISIHNVSPYEMHFLETILYKRRPYG 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG18558NP_608720.2 Galactosyl_T <400..>458 CDD:304462 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289198
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.