DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and CG3119

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster

Alignment Length:255 Identity:69/256 (27%)
Similarity:126/256 (49%) Gaps:30/256 (12%)


  Fly     3 PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEP--YVPVINST-----DTWTLVQQGLMQA 60
            |.|..|  .|:.|..|||:.|:.|:|.|.:   :.||  .|.|:..|     |.|...::|....
  Fly    71 PENVQS--LARSVYETWGQRCSRLIFASSE---DYEPLGVVGVVEPTGGGYEDLWNKTREGFRHV 130

  Fly    61 YLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVIS 125
            :..||...||||:.:..::||:|||::::  |.:.|:.|::|||::...  :.|::...:.|::|
  Fly   131 WEHYAGDYDWFLKADDDTYVVMENLQHLL--RGFDPNTPVFFGYKMSRY--NVSYMSGGASYILS 191

  Fly   126 REALRRYTMASKD-----PENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHET---FLPV 182
            ||||.|:...:.:     |:.|:..     :|...:..|::...|...:|....:.:|   |:|:
  Fly   192 REALHRFATQAYESEVICPQPKKMG-----IEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPL 251

  Fly   183 TMDYQFLNGYDTIP-WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIF 241
            .::....:...||| |||.:|..:........|:.::.|.......|:.|.:.:|.||:|
  Fly   252 DLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVF 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 43/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88699678
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.