DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and tgy

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:315 Identity:90/315 - (28%)
Similarity:153/315 - (48%) Gaps:39/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALILFLILTLYINV--------------------SEVDRKPAKRSNQHTLDPLYEEIRILCMI- 56
            |.|::.|:.|..|.:                    |.||.......|:...:.::.|:|:||.: 
  Fly    40 LVLLILLVSTTVIGLFAYWDVMVLNAGALPLSRGTSSVDYMEPGLRNETLAEKMHREVRVLCWVL 104

  Fly    57 --PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYA 119
              |..:.:  .|.:|.|||||.||.:.|::.:.|.|| |.| |:...|.:.::.....:|::...
  Fly   105 TTPKYHKT--RAIHVLRTWGKRCNKIYFMTSEPDDEL-PTV-VLTKPDRYEMLWGKTKEAFVHIH 165

  Fly   120 DQI----DWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTH---ESFVHHHSGYV 177
            :|:    |||::.:..:::.|||||||::  .|.|..|||||:..:.:.||   ||::...||||
  Fly   166 EQMRHEADWFIKADDDTYLFLENLRYMLY--PYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYV 228

  Fly   178 ISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQF 242
            :||||||.:.....|  ..:|...:.:.|.:::.:||....|...:||||.....|.|:......
  Fly   229 LSREALRIFAEGVND--TTKCRQEDDHAEDVEMGKCLFNLGVKAGDSRDEQLRNRFYPIAPYGAL 291

  Fly   243 LNGYDTIP-WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 296
            |:|...:. ||.|.:|:........:|...:.|...:..::|.|.||.|:.::.|
  Fly   292 LSGNVGMDFWLYKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQFQLSG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 57/174 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.