DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and tgy

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster

Alignment Length:239 Identity:76/240 (32%)
Similarity:126/240 (53%) Gaps:14/240 (6%)


  Fly    12 AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQI----DWFL 72
            |.:|.|||||.||.:.|::.:.|.|| |.| |:...|.:.::.....:|::...:|:    |||:
  Fly   114 AIHVLRTWGKRCNKIYFMTSEPDDEL-PTV-VLTKPDRYEMLWGKTKEAFVHIHEQMRHEADWFI 176

  Fly    73 RVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTH---ESFVHHHSGYVISREALRRYTM 134
            :.:..:::.|||||||::  .|.|..|||||:..:.:.||   ||::...||||:||||||.:..
  Fly   177 KADDDTYLFLENLRYMLY--PYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYVLSREALRIFAE 239

  Fly   135 ASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIP-WL 198
            ...|  ..:|...:.:.|.:::.:||....|...:||||.....|.|:......|:|...:. ||
  Fly   240 GVND--TTKCRQEDDHAEDVEMGKCLFNLGVKAGDSRDEQLRNRFYPIAPYGALLSGNVGMDFWL 302

  Fly   199 RKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            .|.:|:........:|...:.|...:..::|.|.||.|:.::.|
  Fly   303 YKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQFQLSG 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131289129
eggNOG 1 0.900 E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23033
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.