DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C1galt1c1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 RGDID:1311230 Length:316 Species:Rattus norvegicus

Alignment Length:268 Identity:72/269 (27%)
Similarity:113/269 (42%) Gaps:71/269 (26%)


  Fly    15 VKRTWGKHC---------NVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDW 70
            ||.||.|||         ||.:|.|.::|           :.|.|.::::....||..|.||.:|
  Rat    84 VKETWTKHCDKAEFFSSENVKVFESINMD-----------TNDMWLMMRKAYKYAYDKYKDQYNW 137

  Fly    71 FLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGY-----ELENIVTHESFVHHHSGYVISREALR 130
            |....|::|.|:|||:|.:.::  .||||.|.|:     :||       :|....|.|:|.|:::
  Rat   138 FFLARPTTFAVIENLKYFLLRK--DPSQPFYLGHTVKSGDLE-------YVSVDGGIVLSIESMK 193

  Fly   131 RYTMASKDPENKECTHWEGYV----EGLDIHRCLRFA-----NVTVAESRDEFEHET---FLPVT 183
            |.......||  :|....|.:    |...:..||::|     |...|:.:|.|..::   |:...
  Rat   194 RLNGLLSVPE--KCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEA 256

  Fly   184 M---DYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPV 245
            |   ..|.:.|.                    .|..|:.|....|.:|:...|.||||:.||...
  Rat   257 MTNQPNQVVEGC--------------------CSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVF 301

  Fly   246 RNSIDFRP 253
            .:::.|.|
  Rat   302 NDALVFLP 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88723638
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.