DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and bus-4

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_500615.2 Gene:bus-4 / 188726 WormBaseID:WBGene00044620 Length:368 Species:Caenorhabditis elegans


Alignment Length:242 Identity:63/242 - (26%)
Similarity:101/242 - (41%) Gaps:58/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 INVSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNYNSPDTAKY-------VKRTWGKHCNV-LL 81
            :.|||..|..||..:            :||.      :..|:.|       :..||.:.|:. .|
 Worm    83 VKVSESARNQAKSGS------------LLCW------AMTTSIYHKTRVPAITETWLRRCDAGHL 129

  Fly    82 FVSGD------------IDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFV 134
            |.:.|            .||..|.|..:...|      :..|:..|.:.:...||:.:.:..:::
 Worm   130 FTNSDRFLNASTPYHTVFDGLPESYYKLFWKT------RLALLYIYKYVSKDFDWYFKGDDDTYL 188

  Fly   135 VLENL-RYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKE- 197
            ::||| ||:   ....|::|.:.||.|.. .|...:....||||:||||:|.:  |.|...:|: 
 Worm   189 IVENLQRYL---ATLDPNKPYFIGYRLSR-RTETGYNAGGSGYVMSREAMRIF--AEKLFNDKQK 247

  Fly   198 CTH--WEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQF 242
            |.:  ||.|.    |.:||....:...:||||...:.|||...:..|
 Worm   248 CPYHEWEDYA----IAQCLASVGIVPLDSRDEKGRQRFLPWRPEQHF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
bus-4NP_500615.2 Galactosyl_T 104..>235 CDD:304462 36/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.