DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and F37A4.3

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:244 Identity:42/244 - (17%)
Similarity:84/244 - (34%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSPRRVYYGLFLALILFLILTLYIN-----VSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNY 60
            |..|:.::   .|.|:||.:..|..|     .:|.:.|..|..:..:|           .:....
 Worm     1 MMEPKSIF---LLGLLLFRVGKLMRNDKLAWSAEYEAKKFKFYHNTSL-----------FLTLQS 51

  Fly    61 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFY------- 118
            ..|:.....|::|   |:           :::.|..|.:....|    |...:.:|.:       
 Worm    52 TGPEMTNLCKKSW---CD-----------KVDDYFVVPHHYVNW----QKPTEQWLIHHFSKMIL 98

  Fly   119 -----ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVI 178
                 ..|..|::....:::..:|  |.:....|:....|||     ..:....:.:.|....:.
 Worm    99 HTRRLPQQAQWYMFAFDNNYFFVE--RLIKELSKFDSHLPIY-----TILRDFHADIQHKPVLIF 156

  Fly   179 SREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDE 227
            ||.||..:    .|.|.:.|:.....||.. :..|:....:|::..|.:
 Worm   157 SRSALNTF----YDLEEENCSENAENVEEW-LTTCMSIPPITISVDRSK 200



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.