DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and F37A4.3

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans

Alignment Length:177 Identity:30/178 (17%)
Similarity:62/178 (35%) Gaps:42/178 (24%)


  Fly     9 PDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFY--------- 64
            |:.....|::|   |:           :::.|..|.:....|    |...:.:|.:         
 Worm    54 PEMTNLCKKSW---CD-----------KVDDYFVVPHHYVNW----QKPTEQWLIHHFSKMILHT 100

  Fly    65 ---ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISR 126
               ..|..|::....:::..:|  |.:....|:....|||     ..:....:.:.|....:.||
 Worm   101 RRLPQQAQWYMFAFDNNYFFVE--RLIKELSKFDSHLPIY-----TILRDFHADIQHKPVLIFSR 158

  Fly   127 EALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDE 173
            .||..:    .|.|.:.|:.....||.. :..|:....:|::..|.:
 Worm   159 SALNTF----YDLEEENCSENAENVEEW-LTTCMSIPPITISVDRSK 200



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.