DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and E03H4.3

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_493146.2 Gene:E03H4.3 WormBaseID:WBGene00008471 Length:322 Species:Caenorhabditis elegans

Alignment Length:259 Identity:46/260 (18%)
Similarity:104/260 (40%) Gaps:55/260 (21%)


  Fly     6 YNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQ--------------- 55
            ||  |....:..||.:.|:         :|......|:.::..|::.|.:               
 Worm    91 YN--DRVPSIAATWLRRCD---------NGRFFSKTPLPSANMTYSTVYKNLEDSFFDLFRKSIF 144

  Fly    56 GLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHS 120
            |...:|:..::..||:|:.:..::..:::||..::  ...||:|:|.||.:::.:.: .:....:
 Worm   145 GFYYSYMHISNSFDWYLKADDDTYFAMDHLREYLN--TLDPSKPLYLGYVIKSGLKN-GYNSGGA 206

  Fly   121 GYVISREALRRYTMASKDPENKECTHWE-----GYVEGLDIHRCLRFANVTVAESRDEFEHETFL 180
            ||::|..|::.:.        ::..|.|     .:.|...:.|||....:...::||:.....|:
 Worm   207 GYILSNAAVKIFV--------EKLYHDEYGCPYDWAEDRGMGRCLARVGIYPTDTRDDKGFNRFM 263

  Fly   181 PVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYP--------PEMYDYYYFVY 236
            |.....|...........:.:|.|:..:.|:.:....:     :|        |.:.:|.:|.|
 Worm   264 PYRPSEQAAVEAGQFSSQKFVSLHRFPQDTMLLLDELL-----HPELRKNDTNPVVVNYDFFRY 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
E03H4.3NP_493146.2 Galactosyl_T <130..252 CDD:304462 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734928
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.