DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C17A2.3

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans

Alignment Length:261 Identity:64/262 (24%)
Similarity:104/262 (40%) Gaps:49/262 (19%)


  Fly    10 DTAKYVKRTWGKHC-NVLLFVSGDIDGELEPYVPVINST------DTW-TLVQQGLMQAYLFY-- 64
            |....|..||...| :...|....:     ||..:..||      ||: .|.::.:...|..|  
 Worm   115 DRVPSVASTWLPRCDHGRFFTKTHL-----PYPDIAYSTVYRNLRDTYDDLFRKSIFSLYYSYTS 174

  Fly    65 -ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREA 128
             :...||:|:.:..:||.:::||..::  ...|::|:|.||.|...: :..:....|||::|..|
 Worm   175 ISKHFDWYLKTDDDTFVAMDHLREYLN--TLNPAEPLYLGYRLAPFM-NNGYNSGGSGYILSNAA 236

  Fly   129 LRRYTMASKDPEN-----KECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQF 188
            :|.:.      |.     :.|.:..|...|:.  |||....:|.:::||:.|...|:|...    
 Worm   237 MRMFV------EQLYHNVRLCPYDRGEDRGMG--RCLESVGITPSDTRDDQELNRFMPFRP---- 289

  Fly   189 LNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEM---YDYYYFVYRLKIFGTPVRNSID 250
                ..||.:.. .:|....| .|..|:....|...||||   .|...:...    |.|..|..|
 Worm   290 ----AEIPIIGS-KWHYFPLK-YPFISKKFVTLHRVPPEMMISLDKSLYSEN----GEPTFNVTD 344

  Fly   251 F 251
            |
 Worm   345 F 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734888
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.