DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C16D9.6

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans

Alignment Length:221 Identity:54/222 (24%)
Similarity:91/222 (41%) Gaps:47/222 (21%)


  Fly    15 VKRTWGKHC-NVLLFVSGDIDGELEPYVPVINS--TDTWTLVQQGLMQAYLFY------ADQIDW 70
            :..||...| :..||.|...:....||..|...  .|.:.|.   ....|.|:      :.:.||
 Worm   116 INETWIHRCDHGQLFTSERFNDTRIPYSTVFKGIPDDYYNLF---FKSRYAFHHIYTNISSEFDW 177

  Fly    71 FLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALR----- 130
            :|:.:..:||::||||..:  ....|.:|.|.||.|:..:.: .:....:||::||.||:     
 Worm   178 YLKADDDTFVIVENLRSFL--STLNPDEPHYLGYVLKPYLKN-GYNAGGAGYILSRAALKIFSEQ 239

  Fly   131 RYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEF---EHETFLPVTMDYQFLNGY 192
            .|:.|:..|::        ..|.:.|.|||..|.:...::|:..   ...||.|....:|...|.
 Worm   240 LYSNATLCPDD--------IYEDVGIARCLANAGMYPEDTRNSLGQNRFNTFSPSDTFHQTKAGI 296

  Fly   193 DTIPWLR-------------KLSYHK 205
            |   |::             .:|:||
 Worm   297 D---WVKFKENKGYEAFANDLISFHK 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:304462 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88689706
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.