DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and C02H6.1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans

Alignment Length:256 Identity:55/257 (21%)
Similarity:105/257 (41%) Gaps:46/257 (18%)


  Fly     4 YNYNSPDTAKYVKRTWGKHC-NVLLFVSGDIDGELEPYVPVINSTDT--WTLVQQGLMQ---AYL 62
            :|...|..|.    ||...| |...|:...:..|..|:..|..:.:.  :.|.::.|:.   :|.
 Worm    98 FNDRVPSMAS----TWLPRCDNGRFFLKTPLVDEKIPFSTVYRNLEDSYYDLFRKTLLSFYYSYT 158

  Fly    63 FYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISRE 127
            :.:...||:|:.:..::.::::|:..:.  ....|:|::.||.::..: ...:....:||::|..
 Worm   159 YISKDFDWYLKADDDNYFMIDHLKEYLD--TLDASKPLFLGYRMKPFL-EGGYNSGGAGYLLSNA 220

  Fly   128 ALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMD------- 185
            |:|.:.......| |.|.:  .:.|...|.|||....:..:::||......|||....       
 Worm   221 AVRIFVEHLYHDE-KRCPY--DWAEDRGIARCLASMGILPSDTRDNDGSCRFLPFRPSEMPGIPE 282

  Fly   186 ----YQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFL--VEYP--------PEMYDYY 232
                |...||  :....:.:|.|:       ||.|.:.||  :.||        ||.:|.:
 Worm   283 AYHYYPLKNG--SFVSEKFISLHR-------ISPRKMIFLDSILYPSSERRLFTPEFFDIF 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88734898
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.